PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097706001
Common NameGSBRNA2T00097706001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 382aa    MW: 42773.1 Da    PI: 6.8458
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097706001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.4e-3446100155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+Wtp+LHerF+eav+qLGG++kAtPkti+++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00097706001  46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 100
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.22743103IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-3144101IPR009057Homeodomain-like
SuperFamilySSF466894.3E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2346101IPR006447Myb domain, plants
PfamPF002494.4E-104899IPR001005SANT/Myb domain
PfamPF143791.2E-25148193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MYYQNQHQGK SILSSSRMHL ASERHPFLRG GNSPGDSGLI LSTDAKPRLK WTPDLHERFI  60
EAVNQLGGAD KATPKTIMKV MGIPGLTLYH LKSHLQKYRL SKNLNGQANS GLNKIGMMTM  120
IEEKSPDADE IQSESLSIGP QPNKNSPIGE ALQMQIEVQR RLHEQLEVQR HLQLRIEAQG  180
KYLQSVLEKA QETLGRQNLS PAGIEAAKVQ LSELVSKVSA EYPNTSFLDP KEFQNLCPQQ  240
MQTAYPQDSC LTSSEGAQKN PKMLGLRTYL GDSTSEQKEV IEEPLFQRME LTWNEGLRGN  300
PYLSTMVTDA EQRVSYSERS PSTLTMGVGM HGHRGHQQGS NDEDHKLETQ STKTELDLNT  360
HVENCCTTRP KQFDLNGFSW N*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2220890.0HQ222089.1 Arabidopsis thaliana myb family transcription factor (MYR2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130413.10.0PREDICTED: two-component response regulator ARR18 isoform X1
TrEMBLA0A078ILQ80.0A0A078ILQ8_BRANA; BnaA05g37380D protein
STRINGBra031952.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.30.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]